You have no items in your shopping cart.
Cart summary
Porcine IFN alpha protein
Catalog Number: orb1215752
| Catalog Number | orb1215752 |
|---|---|
| Category | Proteins |
| Description | The Swine IFN alpha 1 Biotinylated yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Swine IFN alpha 1 Biotinylated applications are for cell culture. Swine IFN alpha 1 Biotinylated yeast-derived recombinant protein can be purchased in multiple sizes. Swine IFN alpha 1 Biotinylated Specifications: (Molecular Weight: 19.0 kDa) (Amino Acid Sequence: CDLPQTHSLAHTRALRLLAQMRRISPFSCLDHRRDFGSPHEAFGGNQVQKAQAMALVHEMLQQTFQLFSTEGSAAAWNESLLHQFCTGLDQQLRDLEACVMQGAGLEGTPLLEEDSILAVRKYFHRLTLYLQEKSYSPCAWEIVRAEVMRSFSSSRNLQDRLRKKE (166)) (Gene ID: 397686). |
| Target | IFN alpha |
| Form/Appearance | Lyophilized |
| Purity | 98% |
| Protein Sequence | CDLPQTHSLAHTRALRLLAQMRRISPFSCLDHRRDFGSPHEAFGGNQVQKAQAMALVHEMLQQTFQLFSTEGSAAAWNESLLHQFCTGLDQQLRDLEACVMQGAGLEGTPLLEEDSILAVRKYFHRLTLYLQEKSYSPCAWEIVRAEVMRSFSSSRNLQDRLRKKE (166) |
| Protein Length | 121 |
| MW | 19.0 kDa |
| Source | Yeast |
| Biological Origin | Swine |
| Storage | -20°C |
| Note | For research use only |
pIFNA1 Protein [orb1471924]
Greater than 90.0% as determined by SDS-PAGE.
HEK293 cells
1 mg, 2 μg, 10 μgPorcine IFN alpha ELISA Kit [orb1216593]
Porcine
1 set (2 x capture antibody), 1 set (1 x capture antibody)
