You have no items in your shopping cart.
Cart summary
Porcine CXCL9 protein
Catalog Number: orb1216281
| Catalog Number | orb1216281 |
|---|---|
| Category | Proteins |
| Description | The Swine CXCL9 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Swine CXCL9 applications are for cell culture, ELISA standard, and Western Blot Control. The Swine CXCL9 yeast-derived recombinant protein can be purchased in multiple sizes. Swine CXCL9 Specifications: (Molecular Weight: 12.1 kDa) (Amino Acid Sequence: TLLMRNGRCSCINTSQRMIHLKSLRDLKQFAPSPSCEKMEVIATMKNGDQTCLNPDSPDVKKLIKEWEKQVSLKKKQKKGKKHPKTKKVRKVKKSQRPDQKKMT (104)) (Gene ID: 100135681). |
| Target | CXCL9 |
| Form/Appearance | Lyophilized |
| Purity | 98% |
| Protein Sequence | TLLMRNGRCSCINTSQRMIHLKSLRDLKQFAPSPSCEKMEVIATMKNGDQTCLNPDSPDVKKLIKEWEKQVSLKKKQKKGKKHPKTKKVRKVKKSQRPDQKKMT (104) |
| Protein Length | 104 |
| MW | 12.1 kDa |
| Source | Yeast |
| Biological Origin | Swine |
| Storage | -20°C |
| Alternative names | MIG |
| Note | For research use only |
Porcine CXCL9 ELISA Kit [orb1216595]
Porcine
1 set (2 x capture antibody), 1 set (1 x capture antibody)
