You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1215725 |
---|---|
Category | Proteins |
Description | The Swine CCL3L1 Biotinylated yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Swine CCL3L1 Biotinylated applications are for cell culture. Swine CCL3L1 Biotinylated yeast-derived recombinant protein can be purchased in multiple sizes. Swine CCL3L1 Biotinylated Specifications: (Molecular Weight: 7.8 kDa) (Amino Acid Sequence: APLGADTPTACCFSYTSRQLPRKFVADYFETSSQCSKPGVIFQTKKGREVCANPEDAWVQEYISDLELNA) (Gene ID: 494459). |
Target | CCL3L1 |
Form/Appearance | Lyophilized |
Purity | 98% |
Protein Sequence | APLGADTPTACCFSYTSRQLPRKFVADYFETSSQCSKPGVIFQTKKGREVCANPEDAWVQEYISDLELNA |
Protein Length | 70 |
MW | 7.8 kDa |
Source | Yeast |
Biological Origin | Swine |
Storage | -20°C |
Alternative names | LD78 |
Note | For research use only |