Porcine CCL3L1 protein

• Catalog Number: orb1215725
• Category: Proteins
• Description: The Swine CCL3L1 Biotinylated yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Swine CCL3L1 Biotinylated applications are for cell culture. Swine CCL3L1 Biotinylated yeast-derived recombinant protein can be purchased in multiple sizes. Swine CCL3L1 Biotinylated Specifications: (Molecular Weight: 7.8 kDa) (Amino Acid Sequence: APLGADTPTACCFSYTSRQLPRKFVADYFETSSQCSKPGVIFQTKKGREVCANPEDAWVQEYISDLELNA) (Gene ID: 494459).
• Target: CCL3L1
• Form/Appearance: Lyophilized
• Purity: 98%
• Protein Sequence: APLGADTPTACCFSYTSRQLPRKFVADYFETSSQCSKPGVIFQTKKGREVCANPEDAWVQEYISDLELNA
• Protein Length: 70
• MW: 7.8 kDa
• Source: Yeast
• Biological Origin: Swine
• Storage: -20°C
• Alternative names: LD78
• Note: For research use only