Cart summary

You have no items in your shopping cart.

POP7 Rabbit Polyclonal Antibody (Biotin)

POP7 Rabbit Polyclonal Antibody (Biotin)

Catalog Number: orb2082364

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2082364
CategoryAntibodies
DescriptionPOP7 Rabbit Polyclonal Antibody (Biotin)
ClonalityPolyclonal
Species/HostRabbit
ConjugationBiotin
Predicted ReactivityHuman
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
ImmunogenThe immunogen is a synthetic peptide directed towards the N-terminal region of Human POP7
Protein SequenceSynthetic peptide located within the following region: ENREPRGAVEAELDPVEYTLRKRLPSRLPRRPNDIYVNMKTDFKAQLARC
UniProt IDO75817
MW15kDa
Tested applicationsWB
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Alternative namesRPP2, RPP20, 0610037N12Rik
NoteFor research use only
NCBINP_005828