You have no items in your shopping cart.
Cart summary
POLR1C Peptide - N-terminal region
Catalog Number: orb2001484
| Catalog Number | orb2001484 |
|---|---|
| Category | Proteins |
| Description | POLR1C Peptide - N-terminal region |
| Predicted Reactivity | Human |
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized powder |
| Protein Sequence | Synthetic peptide located within the following region: FGVRNVHTTDFPGNYSGYDDAWDQDRFEKNFRVDVVHMDENSLEFDMVGI |
| UniProt ID | O15160 |
| MW | 39 kDa |
| Tested applications | WB |
| Storage | Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles. |
| Alternative names | RPA5, TCS3, RPA39, RPA40, RPAC1 |
| Note | For research use only |
| NCBI | NP_976035.1 |
