You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb8191 |
---|---|
Category | Proteins |
Description | Recombinant of plant DODA protein |
Tag | N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Protein Sequence | MGVGKEVSFKESFFLSHGNPAMLADESFIARNFLLGWKKNVFPVKPKSILVVSAHWETDVPCVSAGQYPNVIYDFTEVPASMFQMKYPAPGCPKLAKRVQELLIAGGFKSAKLDEERGFDHSSWVPLSMMCPEADIPVCQLSVQPGLDATHHFNVGRALAPLKGEGVLFIGSGGAVHPSDDTPHWFDGVAPWAAEFDQWLEDALLEGRYEDVNNYQTKAPEGWKLAHPIPEHFLPLHVAMGAGGEKSKAELIYRTWDHGTLGYASYKFTSI |
Protein Length | Full Length |
UniProt ID | Q7XA48 |
MW | 49.9 kDa |
Application notes | Tag info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-taggedExpression Region: 1-271aaSequence Info: Full LengthGlycerol content: 0.5 |
Endotoxins | Not test. |
Source | E.coli |
Biological Origin | Portulaca grandiflora (Rose moss) |
Expression Region | 1-271aa |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Alternative names | DODA4,5-DOPA dioxygenase extradiol, EC 1.13.11.29 |
Note | For research use only |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.