You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1147055 |
---|---|
Category | Proteins |
Description | Neuropeptide Y2 receptor agonist; Peptides. |
Form/Appearance | Freeze dried solid |
Purity | > 95% by HPLC |
Protein Sequence | H-Ile-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Asn-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH2 |
MW | 4049.6 Da |
H-Ile-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Asn-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH2 | |
C terminal amide. | |
Neuropeptide Y receptors | |
Solubility (25°C) | Soluble in dilute acid |
CAS Number | 126339-09-1 |
Formula | C180H279N53O54 |
Storage | Store dry, dark and frozen |
Alternative names | IKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2, 126339-09- Read more... |
Background | PYY (3-36) is the N-terminal truncated metabolite Read more... |
Note | For research use only |
Human | |
62.5 pg/mL-4000 pg/mL | |
15.6 pg/mL |