You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb582993 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to Pepd |
Target | Pepd |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Mouse |
Predicted Reactivity | Bovine, Canine, Equine, Goat, Guinea pig, Human, Rabbit, Rat, Zebrafish |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Protein Sequence | Synthetic peptide located within the following region: YSRGGMRHTSYTCICCSGENAAVLHYGHAGAPNDRTIKDGDICLFDMGGE |
UniProt ID | Q11136 |
MW | 54kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | d, Pe, Pep, dal, Pep4, Pep-4 |
Note | For research use only |
NCBI | NP_032846 |
WB Suggested Anti-Pepd Antibody, Titration: 1.0 ug/ml, Positive Control: Mouse Small Intestine.
WB | |
Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat, Zebrafish | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Canine, Equine, Gallus, Mouse, Porcine, Rat, Zebrafish | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC, WB | |
Mouse, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |