PDX1 Rabbit Polyclonal Antibody

• Catalog Number: orb576476
• Category: Antibodies
• Description: Rabbit polyclonal antibody to PDX1
• Target: PDX1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human, Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Porcine, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PDX1
• Protein Sequence: Synthetic peptide located within the following region: MNGEEQYYAATQLYKDPCAFQRGPAPEFSASPPACLYMGRQPPPPPPHPF
• UniProt ID: P52945
• MW: 31kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: GSF, IPF1, IUF1, IDX-1, MODY4, PDX-1, STF-1, PAGEN
• Note: For research use only
• NCBI: NP_000200

Sample Tissue: Mouse Testis, Antibody Dilution: 1 ug/ml.

WB Suggested Anti-PDX1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: PANC1 cell lysate. PDX1 is strongly supported by BioGPS gene expression data to be expressed in Human PANC1 cells.