You have no items in your shopping cart.
Cart summary
PDIA3 Peptide - middlel region
Catalog Number: orb1997661
| Catalog Number | orb1997661 |
|---|---|
| Category | Proteins |
| Description | PDIA3 Peptide - middlel region |
| Predicted Reactivity | Mouse |
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized powder |
| Protein Sequence | Synthetic peptide located within the following region: LEPKYKELGEKLSKDPNIVIAKMDATANDVPSPYEVKGFPTIYFSPANKK |
| UniProt ID | P27773 |
| MW | 55 kDa |
| Storage | Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles. |
| Alternative names | Erp, PDI, Plca, 58kDa, ERp57, ERp60, ERp61, Grp58, Read more... |
| Note | For research use only |
| NCBI | NP_031978.2 |
