PCSK5 Rabbit Polyclonal Antibody

• Catalog Number: orb330310
• Category: Antibodies
• Description: Rabbit polyclonal antibody to PCSK5
• Target: PCSK5
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Mouse, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PCSK5
• Protein Sequence: Synthetic peptide located within the following region: CAGAGADGCINCTEGYFMEDGRCVQSCSISYYFDHSSENGYKSCKKCDIS
• UniProt ID: Q92824
• MW: 89kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti PC5 antibody, anti PC6 antibody, anti PC6A an
• Note: For research use only
• NCBI: NP_006191

WB Suggested Anti-PCSK5 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: 293T cell lysate, PCSK5 is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells.