Cart summary

You have no items in your shopping cart.

PARM1 Rabbit Polyclonal Antibody

SKU: orb325317

Description

Rabbit polyclonal antibody to PARM1

Research Area

Cell Biology

Images & Validation

Tested ApplicationsWB
ReactivityHuman
Predicted ReactivityHuman

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the N-terminal region of Human PARM1
TargetPARM1
Protein SequenceSynthetic peptide located within the following region: GSNWEGTNTDPSPSGFSSTSGGVHLTTTLEEHSSGTPEAGVAATLSQSAA
Molecular Weight34kDa
PurificationAffinity purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti PARM1 antibody, anti UNQ1879/PRO4322 antibody, anti antibody

Similar Products

Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

PARM1 Rabbit Polyclonal Antibody

Sample Tissue: Human A549 Whole Cell, Antibody Dilution: 1 ug/mL.

PARM1 Rabbit Polyclonal Antibody

Sample Tissue: Human HT1080 Whole Cell, Antibody Dilution: 1 ug/mL.

PARM1 Rabbit Polyclonal Antibody

Sample Tissue: Human HT1080 Whole Cell, Antibody Dilution: 3 ug/mL.

PARM1 Rabbit Polyclonal Antibody

Sample Type: NCI-H226 Whole Cell lysates, Antibody Dilution: 1.0 ug/mL.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_056208

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

PARM1 Rabbit Polyclonal Antibody (orb325317)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 600.00
DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry