You have no items in your shopping cart.
Parathyroid Hormone (1-44), human
SKU: orb2693886
Description
Images & Validation
−
Key Properties
−| Molecular Weight | 5063.93 |
|---|---|
| Protein Sequence | SVSEIELMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPR |
| Purity | ≥95% |
Storage & Handling
−| Disclaimer | For research use only |
|---|
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Parathyroid Hormone (1-44), human (orb2693886)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a ReviewAvailable Sizes
Select a size below
Usually dispatched within 5-10 working days