Cart summary

You have no items in your shopping cart.

Paqr4 Rabbit Polyclonal Antibody (FITC)

Paqr4 Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2108550

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2108550
CategoryAntibodies
DescriptionPaqr4 Rabbit Polyclonal Antibody (FITC)
ClonalityPolyclonal
Species/HostRabbit
ConjugationFITC
Predicted ReactivityBovine, Canine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Protein SequenceSynthetic peptide located within the following region: ACRPWLRPAALMGYTALSGVAGWRALTAPSTSARLRAFGWQAGARLLVFG
UniProt IDQ568Z3
MW30kDa
Tested applicationsWB
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Alternative namesMGC109357
NoteFor research use only
NCBINP_001017377