You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb578520 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to PAPPA2 |
| Target | PAPPA2 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Human |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human PAPPA2 |
| Protein Sequence | Synthetic peptide located within the following region: ALPQSHFQHSSQHSSGEEEATDLVLTASFEPVNTEWVPFRDEKYPRLEVL |
| UniProt ID | Q9BXP8 |
| MW | 92kDa |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | PAPPE, PLAC3, PAPP-E, PAPP-A2 |
| Research Area | Signal Transduction, Stem Cell & Developmental Bio Read more... |
| Note | For research use only |
| NCBI | NP_068755 |

WB Suggested Anti-PAPPA2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:12500, Positive Control: 293T cell lysate. PAPPA2 is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells.
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review