You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2008022 |
---|---|
Category | Proteins |
Description | PANK2 Peptide - C-terminal region |
Tested applications | WB |
Predicted Reactivity | Human |
Form/Appearance | Lyophilized powder |
MW | 47kDa |
UniProt ID | Q9BZ23 |
Protein Sequence | ERFGLPGWAVASSFGNMMSKEKREAVSKEDLARATLITITNNIGSIARMC |
NCBI | NP_705902 |
Storage | Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles. |
Buffer/Preservatives | Lyophilized powder |
Alternative names | C20orf48, FLJ17232, HARP, HSS, MGC15053, NBIA1, PK Read more... |
Note | For research use only |
Application notes | This is a synthetic peptide designed for use in combination with PANK2 Rabbit Polyclonal Antibody (orb585771). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. |
Expiration Date | 6 months from date of receipt. |