You have no items in your shopping cart.
Pancreatic Polypeptide (1-17)-(Ala31,Aib32)-Neuropeptide Y (18-36) (human)
SKU: orb2693670
Description
Images & Validation
−
Key Properties
−| Molecular Weight | 4124.7 |
|---|---|
| Protein Sequence | APLEPVYPGDNATPEQMARYYSALRHYINLA-{Aib}-RQRY-NH2 |
| Purity | ≥95% |
Storage & Handling
−| Disclaimer | For research use only |
|---|

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Pancreatic Polypeptide (1-17)-(Ala31,Aib32)-Neuropeptide Y (18-36) (human) (orb2693670)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review