Cart summary

You have no items in your shopping cart.

PADI6 Rabbit Polyclonal Antibody (FITC)

PADI6 Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2090973

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2090973
CategoryAntibodies
DescriptionPADI6 Rabbit Polyclonal Antibody (FITC)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityHuman
ImmunogenThe immunogen is a synthetic peptide directed towards the N-terminal region of Human PADI6
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationFITC
MW78kDa
UniProt IDQ6TGC4
Protein SequenceSynthetic peptide located within the following region: GAILLVNCNPADVGQQLEDKKTKKVIFSEEITNLSQMTLNVQGPSCILKK
NCBINP_997304
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative nameshPADVI, PREMBL2
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.