P9R

• Catalog Number: orb1140591
• Category: Proteins
• Description: Defensin like peptide with potent antiviral activity; Antimicrobial peptides.
• Modifications: None
• Structure: H-Asn-Gly-Ala-Ile-Cys-Trp-Gly-Pro-Cys-Pro-Thr-Ala-Phe-Arg-Gln-Ile-Gly-Asn-Cys-Gly-Arg-Phe-Arg-Val-Arg-Cys-Cys-Arg-Ile-Arg-OH
• Target Areas: Antivirals
• Form/Appearance: Freeze dried solid
• Purity: > 95% by HPLC
• MW: 3412.1 Da
• Formula: C₁₄₄H₂₃₂N₅₂O₃₅S₅
• Solubility (25°C): Soluble to 5 ‰mg/ml in water
• Protein Sequence: H-Asn-Gly-Ala-Ile-Cys-Trp-Gly-Pro-Cys-Pro-Thr-Ala-Phe-Arg-Gln-Ile-Gly-Asn-Cys-Gly-Arg-Phe-Arg-Val-Arg-Cys-Cys-Arg-Ile-Arg-OH
• Storage: Store dry, frozen and in the dark
• Alternative names: MERS-CoV CV060, NGAICWGPCPTAFRQIGNCGRFRVRCCRIR, P9
• Background: P9R is a defensin-like peptide that exhibits potent antiviral activity against pH-dependent viruses, including the avian influenza A(H7N9) virus, coronaviruses (SARS-CoV-2, MERS-CoV and SARS-CoV), and the non-enveloped rhinovirus. The antiviral activity of P9R depends on direct binding to viruses and inhibition of virus-host endosomal acidification but when P9R was added to cells after SARS-CoV-2 infection, P9R could significantly inhibit viral replication. P9R can also protect mice in lethal challenge models.
• Note: For research use only
• Expiration Date: 12 months from date of receipt.