You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1140591 |
---|---|
Category | Proteins |
Description | Defensin like peptide with potent antiviral activity; Antimicrobial peptides. |
Form/Appearance | Freeze dried solid |
Purity | > 95% by HPLC |
Protein Sequence | H-Asn-Gly-Ala-Ile-Cys-Trp-Gly-Pro-Cys-Pro-Thr-Ala-Phe-Arg-Gln-Ile-Gly-Asn-Cys-Gly-Arg-Phe-Arg-Val-Arg-Cys-Cys-Arg-Ile-Arg-OH |
MW | 3412.1 Da |
H-Asn-Gly-Ala-Ile-Cys-Trp-Gly-Pro-Cys-Pro-Thr-Ala-Phe-Arg-Gln-Ile-Gly-Asn-Cys-Gly-Arg-Phe-Arg-Val-Arg-Cys-Cys-Arg-Ile-Arg-OH | |
None | |
Antivirals | |
Solubility (25°C) | Soluble to 5 ‰mg/ml in water |
Formula | C144H232N52O35S5 |
Storage | Store dry, frozen and in the dark |
Alternative names | MERS-CoV CV060, NGAICWGPCPTAFRQIGNCGRFRVRCCRIR, P9 Read more... |
Note | For research use only |