You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1140591 |
---|---|
Category | Proteins |
Description | Defensin like peptide with potent antiviral activity; Antimicrobial peptides. |
Form/Appearance | Freeze dried solid |
Purity | > 95% by HPLC |
MW | 3412.1 Da |
Formula | C144H232N52O35S5 |
H-Asn-Gly-Ala-Ile-Cys-Trp-Gly-Pro-Cys-Pro-Thr-Ala-Phe-Arg-Gln-Ile-Gly-Asn-Cys-Gly-Arg-Phe-Arg-Val-Arg-Cys-Cys-Arg-Ile-Arg-OH | |
Solubility (25°C) | Soluble to 5 ‰mg/ml in water |
Protein Sequence | NGAICWGPCPTAFRQIGNCGRFRVRCCRIR |
Storage | Store dry, frozen and in the dark |
Alternative names | MERS-CoV CV060, NGAICWGPCPTAFRQIGNCGRFRVRCCRIR, P9 Read more... |
Background | P9R is a defensin-like peptide that exhibits potent antiviral activity against pH-dependent viruses, including the avian influenza A(H7N9) virus, coronaviruses (SARS-CoV-2, MERS-CoV and SARS-CoV), and the non-enveloped rhinovirus. The antiviral activity of P9R depends on direct binding to viruses and inhibition of virus-host endosomal acidification but when P9R was added to cells after SARS-CoV-2 infection, P9R could significantly inhibit viral replication. P9R can also protect mice in lethal challenge models. |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Filter by Rating