Oxyntomodulin (human, mouse, rat)

SKU: orb2693262

Description

Oxyntomodulin (human, mouse, rat) (Proglucagon (33-69)) is a product of the glucagon precursor. Oxyntomodulin (human, mouse, rat) contains the entire glucagon sequence plus a C-terminal octapeptide, comprising in total 37 amino acids.

Images & Validation

−

Key Properties

−

Target	others
CAS Number	159002-68-3
MW	4449.93
Purity	≥95%
Formula	C₁₉₂H₂₉₅N₆₁O₆₀S
Protein Sequence	HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA

Storage & Handling

−

Expiration Date	6 months from date of receipt.
Disclaimer	For research use only

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Quick Database Links

Gene Symbol

others

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Find More Protocols