Cart summary

You have no items in your shopping cart.

OST4 Rabbit Polyclonal Antibody (FITC)

OST4 Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2091138

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2091138
CategoryAntibodies
DescriptionOST4 Rabbit Polyclonal Antibody (FITC)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityCanine, Human, Mouse, Rat, Zebrafish
ImmunogenThe immunogen is a synthetic peptide directed towards the C-terminal region of Human OST4
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationFITC
MW4kDa
UniProt IDP0C6T2
Protein SequenceSynthetic peptide located within the following region: MITDVQLAIFANMLGVSLFLLVVLYHYVAVNNPKKQE
NCBINP_001128165
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namesDKFZp586A0722
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.