Cart summary

You have no items in your shopping cart.

OR9G9 Rabbit Polyclonal Antibody (Biotin)

OR9G9 Rabbit Polyclonal Antibody (Biotin)

Catalog Number: orb2085406

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2085406
CategoryAntibodies
DescriptionOR9G9 Rabbit Polyclonal Antibody (Biotin)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat
ImmunogenThe immunogen is a synthetic peptide directed towards the C-terminal region of Human OR9G9
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationBiotin
MW33kDa
UniProt IDP0C7N8
Protein SequenceSynthetic peptide located within the following region: YIYALPRSSYSFDMDKIVSTFYTEVLPMLNPMIYSLRNKDVKEALKKLLP
NCBINP_001013376
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namesOR9G1
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.