Cart summary

You have no items in your shopping cart.

OR8I2 Rabbit Polyclonal Antibody (FITC)

OR8I2 Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2085438

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2085438
CategoryAntibodies
DescriptionOR8I2 Rabbit Polyclonal Antibody (FITC)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat
ImmunogenThe immunogen is a synthetic peptide directed towards the C-terminal region of Human OR8I2
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationFITC
MW34kDa
UniProt IDQ8N0Y5
Protein SequenceSynthetic peptide located within the following region: YGSLIFTYLQPDNTSSLTQAQVASVFYTIVIPMLNPLIYSLRNKDVKNAL
NCBINP_001003750
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namesOR11-170
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.