Cart summary

You have no items in your shopping cart.

OR6C70 Rabbit Polyclonal Antibody (Biotin)

OR6C70 Rabbit Polyclonal Antibody (Biotin)

Catalog Number: orb2119108

DispatchUsually dispatched within 5-10 working days
$ 620.00
Catalog Numberorb2119108
CategoryAntibodies
DescriptionOR6C70 Rabbit Polyclonal Antibody (Biotin)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human OR6C70
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationBiotin
MW34kDa
UniProt IDA6NIJ9
Protein SequenceSynthetic peptide located within the following region: GSCMFIYIKPSANERVALSKGVTVLNTSVAPLLNPFIYTLRNQQVKQAFK
NCBINP_001005499
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
NoteFor research use only
Expiration Date12 months from date of receipt.