Cart summary

You have no items in your shopping cart.

OR14I1 Rabbit Polyclonal Antibody (Biotin)

OR14I1 Rabbit Polyclonal Antibody (Biotin)

Catalog Number: orb2085322

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2085322
CategoryAntibodies
DescriptionOR14I1 Rabbit Polyclonal Antibody (Biotin)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityHuman
ImmunogenThe immunogen is a synthetic peptide directed towards the C-terminal region of Human OR14I1
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationBiotin
MW34kDa
UniProt IDA6ND48
Protein SequenceSynthetic peptide located within the following region: LGCFILMMISYFQIFSTVLRIPSGQSRAKAFSTCSPQLIVIMLFLTTGLF
NCBIXP_005273189
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namesOR5BU1, OR5BU1P
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.