You have no items in your shopping cart.
Cart summary
OPN4 Peptide - N-terminal region
Catalog Number: orb1998553
| Catalog Number | orb1998553 |
|---|---|
| Category | Proteins |
| Description | OPN4 Peptide - N-terminal region |
| Predicted Reactivity | Mouse |
| Form/Appearance | Lyophilized powder |
| MW | 51 kDa |
| UniProt ID | Q9QXZ9 |
| Protein Sequence | Synthetic peptide located within the following region: AAAWVPFPTVDVPDHAHYTLGTVILLVGLTGMLGNLTVIYTFCRNRGLRT |
| NCBI | NP_001122071.1 |
| Storage | Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles. |
| Buffer/Preservatives | Lyophilized powder |
| Alternative names | Gm533, 1110007J02Rik Read more... |
| Note | For research use only |
| Expiration Date | 6 months from date of receipt. |
