You have no items in your shopping cart.
Cart summary
Item 1 of 1
ompA Protein
Catalog Number: orb1477209
| Catalog Number | orb1477209 |
|---|---|
| Category | Proteins |
| Description | Recombinant Rickettsia conorii Outer membrane protein A(ompA),partial |
| Tag | C-terminal 6xHis-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| MW | 37.4 kDa |
| UniProt ID | Q52657 |
| Protein Sequence | DMDAKFGAWISPFVGNATQKMCNSISGYKSDTTGGTIGFDGFVSDDLVLGLAYTRADTDIKLKNNKTGDKNKVESNIYSLYGLYSVPYENLFVEAIASYSDNKIRSKSRRVIATTLETVGYQTANGKYKSESYTGQLMAGYTYMMSENINLTPLAGLRYSTIKDKSYKETGTTYQNLTVKGKNYNTFDGLLGAKVSSNINVNEIVLTPELYAMVDYAFKNKVSAIDARLQGMTAPLPTNSFKQSKTSFDVGVGVTAKHKMMEYGINYDTNIGSKYFAQQGSVKVRVNF |
| Protein Length | Partial |
| Source | Baculovirus |
| Biological Origin | Rickettsia conorii (strain ATCC VR-613 / Malish 7) |
| Expression Region | 1734-2021aa |
| Endotoxins | Not test. |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Alternative names | 190KDA antigen Cell surface antigen rOmp A Read more... |
| Note | For research use only |
| Application notes | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Expiration Date | 6 months from date of receipt. |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
- Item 1 of 2
- Item 1 of 3
Bacterial ompA protein [orb383193]
Greater than 90% as determined by SDS-PAGE.
56.3 kDa
E.coli
100 μg, 1 mg, 20 μg - Item 1 of 3
E.coli ompA protein [orb246505]
Greater than 90% as determined by SDS-PAGE.
55.3 kDa
E.coli
20 μg, 100 μg, 1 mg - Item 1 of 3
Viral ompA protein [orb8246]
Greater than 90% as determined by SDS-PAGE.
56.4 kDa
E.coli
20 μg, 100 μg, 1 mg - Item 1 of 3
E.coli ompA protein [orb244688]
Greater than 90% as determined by SDS-PAGE.
56.6 kDa
E.coli
20 μg, 100 μg, 1 mg
