You have no items in your shopping cart.
Omp Pylori Protein
SKU: orb81246
Description
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | E.Coli |
|---|---|
| Protein Sequence | MLVTKLAPDFKAPAVLGNNEVDEHFELSKNLGKNGAILFFWPKDFTFVCPTEIIAFDKRVKDFQEKGFNVIGVSIDSEQVHFAWKNTPVEKGGIGQVTFPMVADITKSISRDYDVLFEEAIALRGAFLIDKNMKVRHAVINDLPLGRNADEMLRMVDALLHFEEHGEVCPAGWRKGDKGMKATHQGVAEYLKENSIKL |
| Purification | Purified by proprietary chromatographic technique. |
| Purity | Greater than 95% pure as determined by 12% PAGE (Coomassie staining). |
Storage & Handling
−| Storage | Stability: Omp Pylori although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles |
|---|---|
| Form/Appearance | Sterile filtered liquid formulation. |
| Buffer/Preservatives | The Omp Pylori recombinant protein is formulated in 1xPBS pH 7.4. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Similar Products
−
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Omp Pylori Protein (orb81246)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review