You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb585069 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to NXN |
Target | NXN |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Protein Sequence | Synthetic peptide located within the following region: VYFSAHWCPPCRSLTRVLVESYRKIKEAGQNFEIIFVSADRSEESFKQYF |
UniProt ID | B4DXQ0 |
MW | 35kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | NRX, RRS2, TRG-4 |
Research Area | Epigenetics & Chromatin, Immunology & Inflammation Read more... |
Note | For research use only |
NCBI | NP_001192248 |
Expiration Date | 12 months from date of receipt. |
WB Suggested Anti-NXN Antibody, Titration: 1.0 ug/ml, Positive Control: NCI-H226 Whole Cell. NXN is supported by BioGPS gene expression data to be expressed in NCIH226.
ELISA, IF, IHC, IP, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC-Fr, IHC-P, WB | |
Human | |
Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |