Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

NUP62 Rabbit Polyclonal Antibody

SKU: orb331391

Description

NUP62 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of NUP62. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the middle region of Human NUP62. This antibody reacts with Human samples and is predicted to react with Canine, Equine, Guinea pig, Mouse, Porcine, Rat. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Cell Biology, Epigenetics & Chromatin, Signal Transduction

Images & Validation

Tested ApplicationsWB
ReactivityHuman
Predicted ReactivityCanine, Equine, Guinea pig, Mouse, Porcine, Rat

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of Human NUP62
TargetNUP62
Protein SequenceSynthetic peptide located within the following region: TAPPGPGAAAGAAASSAMTYAQLESLINKWSLELEDQERHFLQQATQVNA
Molecular Weight57kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

Anti-A170 antibody, anti-EBI 3 associated protein of 60 kDa antibody, anti-EBI 3 associated protein p60 antibody, anti-EBI3 associated protein of 60 kDa antibody, anti-EBI3 associated protein p60 antibody, anti-EBI3-associated protein of 60 kDa antibody, anti-EBIAP antibody, anti-FTDALS3 antibody, anti-MGC127197 antibody, anti-ORCA antibody, anti-OSF-6 antibody, anti-Osi antibody, anti-OSIL antibody, anti-Oxidative stress induced like antibody, anti-p60 antibody, anti-p62 antibody, anti-p62B antibody, anti-Paget disease of bone 3 antibody, anti-PDB 3 antibody, anti-PDB3 antibody, anti-Phosphotyrosine independent ligand for the Lck SH2 domain of 62 kDa antibody, anti-Phosphotyrosine independent ligand for the Lck SH2 domain p62 antibody, anti-Phosphotyrosine-independent ligand for the Lck SH2 domain of 62 kDa antibody, anti-PKC-zeta-interacting protein antibody, anti-Protein kinase C-zeta-interacting protein antibody, anti-Sequestosome 1 antibody, anti-Sequestosome-1 antibody, anti-SQSTM 1 antibody, anti-SQSTM_HUMAN antibody, anti-Sqstm1 antibody, anti-STAP antibody, anti-STONE14 antibody, anti-Ubiquitin binding protein p62 antibody, anti-Ubiquitin-binding protein p62 antibody, anti-ZIP 3 antibody, anti-ZIP antibody, anti-ZIP3 antibody

Similar Products

  • NUP62 Rabbit Polyclonal Antibody [orb1939863]

    ELISA,  FC,  ICC,  IF,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • NUP62 Antibody (C-term E507) [orb1929212]

    FC,  IHC-P,  WB

    Human

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl
  • Nucleoporin p62 Rabbit Polyclonal Antibody (FITC) [orb103138]

    FC,  IF

    Bovine, Canine, Equine, Gallus, Porcine, Rabbit, Rat

    Human, Mouse

    Rabbit

    Polyclonal

    FITC

    100 μl
  • Nucleoporin p62 Rabbit Polyclonal Antibody [orb101041]

    FC,  IF,  IHC-Fr,  IHC-P

    Bovine, Canine, Equine, Gallus, Porcine, Rabbit, Rat

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • NUP62 Rabbit Polyclonal Antibody [orb629479]

    ELISA,  IHC,  WB

    Human

    Rabbit

    Polyclonal

    Unconjugated

    100 μg, 50 μg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_714941

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry