NUP62 Rabbit Polyclonal Antibody

SKU: orb331391

Description

Rabbit polyclonal antibody to NUP72

Research Area

Cell Biology, Epigenetics & Chromatin, Signal Transduction

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Canine, Equine, Guinea pig, Mouse, Porcine, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human NUP62
• Target: NUP62
• Protein Sequence: Synthetic peptide located within the following region: TAPPGPGAAAGAAASSAMTYAQLESLINKWSLELEDQERHFLQQATQVNA
• Molecular Weight: 57kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

Anti-A170 antibody, anti-EBI 3 associated protein of 60 kDa antibody, anti-EBI 3 associated protein p60 antibody, anti-EBI3 associated protein of 60 kDa antibody, anti-EBI3 associated protein p60 antibody, anti-EBI3-associated protein of 60 kDa antibody, anti-EBIAP antibody, anti-FTDALS3 antibody, anti-MGC127197 antibody, anti-ORCA antibody, anti-OSF-6 antibody, anti-Osi antibody, anti-OSIL antibody, anti-Oxidative stress induced like antibody, anti-p60 antibody, anti-p62 antibody, anti-p62B antibody, anti-Paget disease of bone 3 antibody, anti-PDB 3 antibody, anti-PDB3 antibody, anti-Phosphotyrosine independent ligand for the Lck SH2 domain of 62 kDa antibody, anti-Phosphotyrosine independent ligand for the Lck SH2 domain p62 antibody, anti-Phosphotyrosine-independent ligand for the Lck SH2 domain of 62 kDa antibody, anti-PKC-zeta-interacting protein antibody, anti-Protein kinase C-zeta-interacting protein antibody, anti-Sequestosome 1 antibody, anti-Sequestosome-1 antibody, anti-SQSTM 1 antibody, anti-SQSTM_HUMAN antibody, anti-Sqstm1 antibody, anti-STAP antibody, anti-STONE14 antibody, anti-Ubiquitin binding protein p62 antibody, anti-Ubiquitin-binding protein p62 antibody, anti-ZIP 3 antibody, anti-ZIP antibody, anti-ZIP3 antibody

Sample Type: Jurkat Whole Cell lysates, Antibody dilution: 1.0 ug/ml. NUP62 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells.

Quick Database Links

Gene Symbol

NUP62

UniProt

P37198

RefSeq (Protein):NP_714941