You have no items in your shopping cart.
Description
Research Area
Images & Validation
−| Tested Applications | IHC, WB |
|---|---|
| Reactivity | Human, Rat |
| Predicted Reactivity | Bovine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Zebrafish |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human NTRK3 |
| Target | NTRK3 |
| Protein Sequence | Synthetic peptide located within the following region: ERPRVCPKEVYDVMLGCWQREPQQRLNIKEIYKILHALGKATPIYLDILG |
| Molecular Weight | 89kDa |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−Trk C rabbit pAb Antibody [orb766770]
ELISA, WB
Human, Mouse, Rat
Polyclonal
Unconjugated
100 μl, 50 μlTrkC Rabbit Polyclonal Antibody [orb11519]
ELISA, WB
Human, Mouse, Rat
Human
Rabbit
Polyclonal
Unconjugated
100 μl, 200 μl, 50 μlTRKC Antibody (N-term) [orb1928980]
IHC-P, WB
Mouse, Porcine, Rat
Human
Rabbit
Polyclonal
Unconjugated
100 μl, 50 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Sample Type: Human Fetal Brain, Antibody dilution: 1.0 ug/ml.

Sample Tissue: Rat Liver, Antibody dilution: 1 ug/ml.

Sample Type: Human 293T, Antibody dilution: 1.0 ug/ml.

Sample Type: Human Fetal Muscle, Antibody dilution: 1.0 ug/ml.

Sample Tissue: Rat Liver, Antibody dilution: 1 ug/ml.

Rabbit Anti-NTRK3 antibody, Formalin Fixed Paraffin Embedded Tissue: Human Brain, Cerebellum, Primary antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-NTRK3 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Human Liver.
Documents Download
Request a Document
Protocol Information
NTRK3 Rabbit Polyclonal Antibody (orb581342)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review







