NTRK3 Rabbit Polyclonal Antibody

• Catalog Number: orb581342
• Category: Antibodies
• Description: Rabbit polyclonal antibody to NTRK3
• Target: NTRK3
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human, Rat
• Predicted Reactivity: Bovine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human NTRK3
• Protein Sequence: Synthetic peptide located within the following region: ERPRVCPKEVYDVMLGCWQREPQQRLNIKEIYKILHALGKATPIYLDILG
• UniProt ID: Q16288
• MW: 89kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: TRKC, GP145-TrkC, gp145(trkC)
• Note: For research use only
• NCBI: NP_002521

Sample Type: Human Fetal Brain, Antibody dilution: 1.0 ug/ml.

Sample Tissue: Rat Liver, Antibody dilution: 1 ug/ml.

Sample Type: Human 293T, Antibody dilution: 1.0 ug/ml.

Sample Type: Human Fetal Muscle, Antibody dilution: 1.0 ug/ml.

Sample Tissue: Rat Liver, Antibody dilution: 1 ug/ml.

Rabbit Anti-NTRK3 antibody, Formalin Fixed Paraffin Embedded Tissue: Human Brain, Cerebellum, Primary antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-NTRK3 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Human Liver.