You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1140586 |
---|---|
Category | Proteins |
Description | Blocks ASIC1a binding to RIPK1; Cell penetrating peptides. |
Form/Appearance | Freeze dried solid |
Purity | > 95% by hplc |
Protein Sequence | H-Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg-Arg-Cys-Met-Glu-Leu-Lys-Thr-Glu-Glu-Glu-Glu-Val-Gly-Gly-Val-Gln-Pro-Val-Ser-Ile-Gln-Ala-OH |
MW | 3655.22 Da |
H-Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg-Arg-Cys-Met-Glu-Leu-Lys-Thr-Glu-Glu-Glu-Glu-Val-Gly-Gly-Val-Gln-Pro-Val-Ser-Ile-Gln-Ala-OH | |
None | |
Protein-protein interactions, Kinases, Acid sensing ion channels | |
Solubility (25°C) | Soluble in water |
Formula | C150H265N55O47S2 |
Storage | Store dry, frozen and in the dark |
Alternative names | GRKKRRQRRRCMELKTEEEEVGGVQPVSIQA, NT1-20, NT1-20 , Read more... |
Background | NT1-20 is a tatylated membrane penetrating peptide Read more... |
Note | For research use only |