You have no items in your shopping cart.
You have no items in your shopping cart.

| Catalog Number | orb1140586 |
|---|---|
| Category | Proteins |
| Description | Blocks ASIC1a binding to RIPK1; Cell penetrating peptides. |
| Form/Appearance | Freeze dried solid |
| Purity | > 95% by hplc |
| Protein Sequence | H-Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg-Arg-Cys-Met-Glu-Leu-Lys-Thr-Glu-Glu-Glu-Glu-Val-Gly-Gly-Val-Gln-Pro-Val-Ser-Ile-Gln-Ala-OH |
| MW | 3655.22 Da |
| H-Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg-Arg-Cys-Met-Glu-Leu-Lys-Thr-Glu-Glu-Glu-Glu-Val-Gly-Gly-Val-Gln-Pro-Val-Ser-Ile-Gln-Ala-OH | |
| None | |
| Protein-protein interactions, Kinases, Acid sensing ion channels | |
| Solubility (25°C) | Soluble in water |
| Formula | C150H265N55O47S2 |
| Storage | Store dry, frozen and in the dark |
| Alternative names | GRKKRRQRRRCMELKTEEEEVGGVQPVSIQA, NT1-20, NT1-20 , Read more... |
| Background | NT1-20 is a tatylated membrane penetrating peptide Read more... |
| Research Area | Protein Biochemistry |
| Note | For research use only |
| Expiration Date | 12 months from date of receipt. |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review