Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

NT1-20

SKU: orb1140586

Description

Blocks ASIC1a binding to RIPK1; Cell penetrating peptides.

Research Area

Protein Biochemistry

Images & Validation

Key Properties

MW3655.22 Da
Purity> 95% by hplc
FormulaC150H265N55O47S2
Protein SequenceH-Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg-Arg-Cys-Met-Glu-Leu-Lys-Thr-Glu-Glu-Glu-Glu-Val-Gly-Gly-Val-Gln-Pro-Val-Ser-Ile-Gln-Ala-OH

Storage & Handling

StorageStore dry, frozen and in the dark
Form/AppearanceFreeze dried solid
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

GRKKRRQRRRCMELKTEEEEVGGVQPVSIQA, NT1-20, NT1-20 , Peptide NT1-20
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Protocol Information

Protein Handling and Storage Guide
Protein Handling Guide
View Guide

Available Sizes

Select a size below

1 mg
$ 390.00
DispatchUsually dispatched within 5-10 working days
Bulk Enquiry