NRP1 Peptide - middle region

• Catalog Number: orb1999371
• Category: Proteins
• Description: NRP1 Peptide - middle region
• Predicted Reactivity: Human
• Form/Appearance: Lyophilized powder
• Buffer/Preservatives: Lyophilized powder
• Protein Sequence: Synthetic peptide located within the following region: IGYSNNGSDWKMIMDDSKRKAKSFEGNNNYDTPELRTFPALSTRFIRIYP
• UniProt ID: O14786
• MW: 70 kDa
• Storage: Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
• Alternative names: NP1, NRP, BDCA4, CD304, VEGF165R
• Note: For research use only
• NCBI: NP_001019799.1