NRL Peptide - middle region

• Catalog Number: orb1997995
• Category: Proteins
• Description: NRL Peptide - middle region
• Predicted Reactivity: Mouse
• Form/Appearance: Lyophilized powder
• Buffer/Preservatives: Lyophilized powder
• Protein Sequence: Synthetic peptide located within the following region: DAALVSMSVRELNRQLRGCGRDEALRLKQRRRTLKNRGYAQACRSKRLQQ
• UniProt ID: P54846
• MW: 26 kDa
• Storage: Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
• Alternative names: D14H14S46E
• Note: For research use only
• NCBI: NP_001129546.1