Cart summary

You have no items in your shopping cart.

NRL Peptide - C-terminal region

NRL Peptide - C-terminal region

Catalog Number: orb2003129

DispatchUsually dispatched within 5-10 working days
$ 230.00
Catalog Numberorb2003129
CategoryProteins
DescriptionNRL Peptide - C-terminal region
Predicted ReactivityHuman
Form/AppearanceLyophilized powder
Buffer/PreservativesLyophilized powder
Protein SequenceSynthetic peptide located within the following region: LEAERARLAAQLDALRAEVARLARERDLYKARCDRLTSSGPGSGDPSHLF
UniProt IDP54845
MW26kDa
Tested applicationsWB
Application notesThis is a synthetic peptide designed for use in combination with NRL Rabbit Polyclonal Antibody (orb583899). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
StorageAdd 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Alternative namesNRL,D14S46E,
NoteFor research use only
NCBIXP_005267767