You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2004439 |
---|---|
Category | Proteins |
Description | NOX4 Peptide - middle region |
Predicted Reactivity | Human |
Form/Appearance | Lyophilized powder |
Buffer/Preservatives | Lyophilized powder |
Protein Sequence | Synthetic peptide located within the following region: VCMVVVLFLMITASTYAIRVSNYDIFWYTHNLFFVFYMLLTLHVSGDDWK |
UniProt ID | E9PI95 |
MW | 37kDa |
Tested applications | WB |
Application notes | This is a synthetic peptide designed for use in combination with NOX4 Rabbit Polyclonal Antibody (orb578136). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. |
Storage | Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles. |
Note | For research use only |