You have no items in your shopping cart.
NOBOX Rabbit Polyclonal Antibody
SKU: orb577438
Description
Research Area
Epigenetics & Chromatin, Stem Cell & Developmental Biology
Images & Validation
−Item 1 of 3
| Tested Applications | IHC, WB |
|---|---|
| Reactivity | Human |
| Predicted Reactivity | Human |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human NOBOX |
| Target | NOBOX |
| Protein Sequence | Synthetic peptide located within the following region: FPVCGLYRIYGVCGSFSSFFIIRCSLCALETLKSPQHDPLEIPEQSLKLI |
| Molecular Weight | 54kDa |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−OG2, OG-2, OG2X, POF5, TCAG_12042
Similar Products
−- Item 1 of 1
- Item 1 of 1
- Item 1 of 1
- Item 1 of 1
- Item 1 of 1
NOBOX Rabbit Polyclonal Antibody [orb783042]
IF, IHC-Fr, IHC-P
Mouse
Rat
Rabbit
Polyclonal
Unconjugated
200 μl, 50 μl, 100 μl
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Human Heart
Human Liver
WB Suggested Anti-NOBOX Antibody Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate.
Quick Database Links
UniProt Details
− No UniProt data available
NCBI Reference Sequences
−Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product| RefSeq | XP_001134424 |
|---|
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
WB
Western Blot (IB, immunoblot)
IHC
Immunohistochemistry
NOBOX Rabbit Polyclonal Antibody (orb577438)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a ReviewAvailable Sizes
Select a size below
Usually dispatched within 3-7 working days