You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb575438 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to NMUR2 |
| Target | NMUR2 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Human |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 1.0 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Protein A purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human NMUR2 |
| Protein Sequence | Synthetic peptide located within the following region: MSGMEKLQNASWIYQQKLEDPFQKHLNSTEEYLAFLCGPRRSHFFLPVSV |
| UniProt ID | Q9GZQ4 |
| MW | 46kDa |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | FM4, FM-4, TGR1, NMU2R, TGR-1, NMU-R2 |
| Research Area | Immunology & Inflammation, Neuroscience, Pharmacol Read more... |
| Note | For research use only |
| NCBI | NP_064552 |

Positive control (+): Mouse Testis (M-TE), Negative control (-): Mouse Heart (M-HE), Antibody concentration: 1 ug/ml.

WB Suggested Anti-NMUR2 Antibody, Titration: 2.5 ug/ml, Positive Control: HepG2 Whole Cell.
ELISA, WB | |
Mouse, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
ICC, IF | |
Bovine, Equine, Human, Porcine, Rabbit, Sheep | |
Rabbit | |
Polyclonal | |
PE |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review