Cart summary

You have no items in your shopping cart.

NMRAL1 Rabbit Polyclonal Antibody (Biotin)

NMRAL1 Rabbit Polyclonal Antibody (Biotin)

Catalog Number: orb2099971

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2099971
CategoryAntibodies
DescriptionNMRAL1 Rabbit Polyclonal Antibody (Biotin)
ClonalityPolyclonal
Species/HostRabbit
ConjugationBiotin
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human NMRAL1
Protein SequenceSynthetic peptide located within the following region: TCRHTAEEYAALLTKHTRKVVHDAKMTPEDYEKLGFPGARDLANMFRFYA
UniProt IDQ9HBL8
MW33kDa
Tested applicationsWB
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Alternative namesHSCARG, SDR48A1
NoteFor research use only
NCBINP_065728