Cart summary

You have no items in your shopping cart.

NLRX1 Peptide - N-terminal region

NLRX1 Peptide - N-terminal region

Catalog Number: orb2003596

DispatchUsually dispatched within 5-10 working days
$ 230.00
Catalog Numberorb2003596
CategoryProteins
DescriptionNLRX1 Peptide - N-terminal region
Predicted ReactivityHuman
Form/AppearanceLyophilized powder
Buffer/PreservativesLyophilized powder
Protein SequenceSynthetic peptide located within the following region: GSHLLFVLHGLEHLNLDFRLAGTGLCSDPEEPQEPAAIIVNLLRKYMLPQ
UniProt IDQ86UT6
MW101kDa
Tested applicationsWB
Application notesThis is a synthetic peptide designed for use in combination with NLRX1 Rabbit Polyclonal Antibody (orb586183). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
StorageAdd 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Alternative namesCLR11.3, DLNB26, NOD26, NOD5, NOD9
NoteFor research use only
NCBINP_733840
Expiration Date6 months from date of receipt.