Cart summary

You have no items in your shopping cart.

NFATC1 Rabbit Polyclonal Antibody (FITC)

NFATC1 Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2128545

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2128545
CategoryAntibodies
DescriptionNFATC1 Rabbit Polyclonal Antibody (FITC)
ClonalityPolyclonal
Species/HostRabbit
ConjugationFITC
Predicted ReactivityGuinea pig, Human, Mouse, Rat
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human NFATC1
Protein SequenceSynthetic peptide located within the following region: PSTSFPVPSKFPLGPAAAVFGRGETLGPAPRAGGTMKSAEEEHYGYASSN
UniProt IDQ2M1S3
MW78kDa
Tested applicationsIHC, WB
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Alternative namesNFAT2, NFATc, NF-ATC, NF-ATc1.2
NoteFor research use only
NCBINP_765978