Neuropeptide W-30 (human)

SKU: orb2694278

Description

Neuropeptide W-30 is a peptide that has been shown to activate the receptor for neuropeptide W (NPW). Neuropeptide W is a member of the tachykinin family of peptides, which are known to function as activators of G protein-coupled receptors. Neuropeptide W-30 has been shown to be a potent inhibitor of ion channels and ligand-gated ion channels, including potassium channels, calcium channels, and sodium channels. Neuropeptide W-30 also blocks the release of neurotransmitters such as acetylcholine, noradrenaline, dopamine, and serotonin in animal cells.

Key Properties

• Target: others
• CAS Number: 383415-80-3
• MW: 3543.17
• Purity: ≥95%
• Formula: C₁₆₅H₂₄₉N₄₉O₃₇S
• Protein Sequence: WYKHVASPRYHTVGRAAGLLMGLRRSPYLW

Storage & Handling

• Expiration Date: 6 months from date of receipt.
• Disclaimer: For research use only

Quick Database Links

Gene Symbol

others