Cart summary

You have no items in your shopping cart.

NDUFAF8 Rabbit Polyclonal Antibody (FITC)

NDUFAF8 Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2087082

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2087082
CategoryAntibodies
DescriptionNDUFAF8 Rabbit Polyclonal Antibody (FITC)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityCanine, Human, Mouse, Rat
ImmunogenThe immunogen is a synthetic peptide directed towards the N-terminal region of Human C17orf89
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationFITC
MW8kDa
UniProt IDA1L188
Protein SequenceSynthetic peptide located within the following region: VWGRVRSRLRAFPERLAACGAEAAAYGRCVQASTAPGGRLSKDFCAREFE
NCBINP_001079990
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namesMC1DN34, C17orf89
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.