You have no items in your shopping cart.
Cart summary
NCKIPSD Peptide - middle region
Catalog Number: orb2009825
| Catalog Number | orb2009825 |
|---|---|
| Category | Proteins |
| Description | NCKIPSD Peptide - middle region |
| Predicted Reactivity | Human |
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized powder |
| Protein Sequence | LVSSVLPVELARDMQTDTQDHQKLCYSALILAMVFSMGEAVPYAHYEHLG |
| UniProt ID | Q9NZQ3 |
| MW | 79kDa |
| Tested applications | WB |
| Application notes | This is a synthetic peptide designed for use in combination with NCKIPSD Rabbit Polyclonal Antibody (orb584360). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. |
| Storage | Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles. |
| Alternative names | AF3P21, DIP, DIP1, MGC23891, ORF1, SPIN90, WASLBP, Read more... |
| Note | For research use only |
| NCBI | NP_909119 |
