You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb584360 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to NCKIPSD |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Guinea pig, Mouse, Rat |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human NCKIPSD |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 79kDa |
Target | NCKIPSD |
UniProt ID | Q9NZQ3 |
Protein Sequence | Synthetic peptide located within the following region: LVSSVLPVELARDMQTDTQDHQKLCYSALILAMVFSMGEAVPYAHYEHLG |
NCBI | NP_909119 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | DIP, DIP1, ORF1, WISH, VIP54, AF3P21, SPIN90, WASL Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
WB Suggested Anti-NCKIPSD Antibody, Titration: 1.0 ug/ml, Positive Control: Fetal Liver.
IF, IHC-Fr, IHC-P | |
Bovine, Porcine, Rabbit, Sheep | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC, IP, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, ICC, IF, IHC-Fr, IHC-P | |
Porcine | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Guinea pig, Human, Mouse, Rabbit | |
Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat | |
Rabbit | |
Polyclonal | |
HRP |