PBEF1 Rabbit Polyclonal Antibody

• Catalog Number: orb324989
• Category: Antibodies
• Description: Rabbit polyclonal antibody against Visfatin 1
• Target: NAMPT
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human PBEF1
• Protein Sequence: Synthetic peptide located within the following region: VTLEEGKGDLEEYGQDLLHTVFKNGKVTKSYSFDEIRKNAQLNIELEAAH
• UniProt ID: P43490
• MW: 54kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti-NAmPRTase antibody, anti-Nampt antibody, anti
• Note: For research use only
• NCBI: NP_005737

Sample Type: Human Adult Placenta, Antibody Dilution: 1.0 ug/mL.

Rabbit Anti-PBEF1 Antibody, Paraffin Embedded Tissue: Human Kidney, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/mL, Magnification: 400X.

WB Suggested Anti-PBEF1 Antibody Titration: 1.25 ug/mL, Positive Control: Jurkat cell lysate.