Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

PBEF1 Rabbit Polyclonal Antibody

SKU: orb324989

Description

Rabbit polyclonal antibody against Visfatin 1

Research Area

Cardiovascular Research, Cell Biology, Disease Biomarkers, Epigenetics & Chromatin

Images & Validation

Tested ApplicationsIHC, WB
ReactivityHuman
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human PBEF1
TargetNAMPT
Protein SequenceSynthetic peptide located within the following region: VTLEEGKGDLEEYGQDLLHTVFKNGKVTKSYSFDEIRKNAQLNIELEAAH
Molecular Weight54kDa
PurificationProtein A purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration1.0 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti-NAmPRTase antibody, anti-Nampt antibody, anti-NAMPT_HUMAN antibody, anti-Nicotinamide phosphoribosyltransferase antibody, anti-PBEF 1 antibody, anti-PBEF antibody, anti-PBEF1 antibody, anti-Pre B cell colony enhancing factor 1 antibody, anti-Pre B cell colony enhancing factor antibody, anti-Pre B cell enhancing factor antibody, anti-Pre-B cell-enhancing factor antibody, anti-Pre-B-cell colony-enhancing factor 1 antibody, anti-VF antibody, anti-Visfatin antibody, anti-Visfatin 1 antibody

Similar Products

  • Visfatin Rabbit Polyclonal Antibody [orb11562]

    FC,  IF,  IHC-Fr,  IHC-P

    Bovine, Equine, Gallus, Monkey, Mouse, Porcine

    Human, Rat

    Rabbit

    Polyclonal

    Unconjugated

    200 μl, 50 μl, 100 μl
  • Visfatin/NAMPT Rabbit Polyclonal Antibody [orb371743]

    ELISA,  FC,  ICC,  IF,  IHC,  IHC-Fr,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • Visfatin Rabbit Polyclonal Antibody [orb11564]

    FC,  IF,  IHC-Fr,  IHC-P

    Bovine, Canine, Equine, Gallus, Monkey, Mouse

    Human, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • NAMPT Rabbit Polyclonal Antibody [orb632522]

    ELISA,  IHC,  IP,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg, 50 μg
  • Visfatin Rabbit Polyclonal Antibody [orb378191]

    IF,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl, 30 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

PBEF1 Rabbit Polyclonal Antibody

Sample Type: Human Adult Placenta, Antibody Dilution: 1.0 ug/mL.

PBEF1 Rabbit Polyclonal Antibody

Rabbit Anti-PBEF1 Antibody, Paraffin Embedded Tissue: Human Kidney, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/mL, Magnification: 400X.

PBEF1 Rabbit Polyclonal Antibody

WB Suggested Anti-PBEF1 Antibody Titration: 1.25 ug/mL, Positive Control: Jurkat cell lysate.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_005737

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

PBEF1 Rabbit Polyclonal Antibody (orb324989)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 530.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry