MYCNOS Rabbit Polyclonal Antibody

• Catalog Number: orb581385
• Category: Antibodies
• Description: Rabbit polyclonal antibody to MYCNOS
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Human
• Reactivity: Human
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 12kDa
• Target: MYCNOS
• UniProt ID: P40205
• Protein Sequence: Synthetic peptide located within the following region: WGGETDASNPAPALTACCAAEREANVEQGLAGRLLLCNYERRLVRRCKIA
• NCBI: NP_006307
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: NCYM, NYCM, N-CYM, MYCN-AS1
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Human Hela Whole Cell, Antibody dilution: 1 ug/ml.

Sample Tissue: Human SGC-7901 Whole Cell, Antibody dilution: 5 ug/ml.

WB Suggested Anti-MYCNOS Antibody, Titration: 1.0 ug/ml, Positive Control: HepG2 Whole Cell.