You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb581385 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to MYCNOS |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Human |
Reactivity | Human |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 12kDa |
Target | MYCNOS |
UniProt ID | P40205 |
Protein Sequence | Synthetic peptide located within the following region: WGGETDASNPAPALTACCAAEREANVEQGLAGRLLLCNYERRLVRRCKIA |
NCBI | NP_006307 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | NCYM, NYCM, N-CYM, MYCN-AS1 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Sample Tissue: Human Hela Whole Cell, Antibody dilution: 1 ug/ml.
Sample Tissue: Human SGC-7901 Whole Cell, Antibody dilution: 5 ug/ml.
WB Suggested Anti-MYCNOS Antibody, Titration: 1.0 ug/ml, Positive Control: HepG2 Whole Cell.
ELISA, ICC, IF, IHC-Fr, IHC-P | |
Rabbit | |
Polyclonal | |
Unconjugated |