MUTYH Antibody

SKU: orb153336

Description

Polyclonal antibody to MUTYH. MUTYH is involved in oxidative DNA damage repair. It nicks DNA replication errors, specifically A/G mismatches.

Images & Validation

• Tested Applications: WB
• Dilution Range: WB:1:500-1:2,000
• Reactivity: Bovine, Canine, Donkey, Equine, Feline, Gallus, Goat, Guinea pig, Hamster, Human, Mouse, Other, Porcine, Primate, Rabbit, Rat, Sheep
• Application Notes:
  The antibody solution should be gently mixed before use.

Key Properties

• Host: Goat
• Clonality: Polyclonal
• Isotype: IgG
• Immunogen: Antigen: Purified recombinant peptide derived from within residues 476 aa to the C-terminus of human Mutyh produced in E. coli. Antigen Sequence: MKKVFRVYQGQQPGTCMGSKRSQVSSPCSRKKPRMGQQVLDNFFRSHISTDAHSLNSAAQ
• Target: MutY homolog (E. coli)
• Purification: Epitope affinity purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Form/Appearance: Polyclonal antibody supplied as a 200 µl (3 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum.
• Concentration: Please inquire
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

MYH, CYP2C, MGC4416, Myh, Mutyha, Mutyhb, Mutyhc, Mutyhbeta, Mutyhalpha, 5730495A01Rik, MGC156598, MUTYH, MGC128714, MGC145569 antibody.

Western blot analysis of HEK293 cell line lysate and NusA-Mutyh (C-term) recombinant protein using MUTYH antibody.

Quick Database Links

Gene Symbol

MutY homolog (E. coli)