You have no items in your shopping cart.
Cart summary
MPZ Peptide - middle region
Catalog Number: orb2001281
| Catalog Number | orb2001281 |
|---|---|
| Category | Proteins |
| Description | MPZ Peptide - middle region |
| Predicted Reactivity | Human |
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized powder |
| Protein Sequence | Synthetic peptide located within the following region: AALQRRLSAMEKGKLHKPGKDASKRGRQTPVLYAMLDHSRSTKAVSEKKA |
| UniProt ID | P25189 |
| MW | 28 kDa |
| Tested applications | WB |
| Storage | Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles. |
| Alternative names | P0, CHM, DSS, MPP, CMT1, CMT1B, CMT2I, CMT2J, CMT4 Read more... |
| Note | For research use only |
| NCBI | NP_000521.2 |
