Cart summary

You have no items in your shopping cart.

MPHOSPH10 Peptide - middle region

MPHOSPH10 Peptide - middle region

Catalog Number: orb2001453

DispatchUsually dispatched within 5-10 working days
$ 230.00
Catalog Numberorb2001453
CategoryProteins
DescriptionMPHOSPH10 Peptide - middle region
Tested applicationsWB
Predicted ReactivityHuman
Form/AppearanceLyophilized powder
MW79 kDa
UniProt IDO00566
Protein SequenceSynthetic peptide located within the following region: ETDEDDDLQENEDNKQHKESLKRVTFALPDDAETEDTGVLNVKKNSDEVK
NCBINP_005782.1
StorageAdd 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Buffer/PreservativesLyophilized powder
Alternative namesCT90, MPP10, MPP10P, PPP1R106
Read more...
NoteFor research use only
Expiration Date6 months from date of receipt.